SCOPe 2.08: Domain d6pufg1: 6puf G:2-110

Lineage for d6pufg1 (6puf G:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6pufg1: 6puf G:2-110 [380950]
   Other proteins in same PDB: d6pufa1, d6pufa3, d6pufb1, d6pufb2, d6pufc1, d6pufc3, d6pufd2, d6puff1, d6puff2, d6pufg2
   automated match to d2f54d1
   complexed with 2lj, gol, na

Details for d6pufg1

PDB Entry: 6puf, 1.92 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-5'd-5-op-ru

PDB Compounds: (G:) Human TCR alpha chain

SCOPe Domain Sequences for d6pufg1:

Sequence; same for both SEQRES and ATOM records:

>d6pufg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d6pufg1:

• d6pufg1 first appeared in SCOPe 2.07