Lineage for d1askb_ (1ask B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326465Superfamily d.17.4: NTF2-like [54427] (8 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 326489Family d.17.4.2: NTF2-like [54431] (5 proteins)
  6. 326504Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 326517Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries)
  8. 326525Domain d1askb_: 1ask B: [38095]
    mutant

Details for d1askb_

PDB Entry: 1ask (more details), 2.3 Å

PDB Description: nuclear transport factor 2 (ntf2) h66a mutant

SCOP Domain Sequences for d1askb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1askb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqasitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal

SCOP Domain Coordinates for d1askb_:

Click to download the PDB-style file with coordinates for d1askb_.
(The format of our PDB-style files is described here.)

Timeline for d1askb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aska_