Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6puef1: 6pue F:1-99 [380948] Other proteins in same PDB: d6puea1, d6puea2, d6puea3, d6puec1, d6puec2, d6puec3, d6pued1, d6pued2, d6puee1, d6puee2, d6puef2, d6pueg1, d6pueg2, d6pueh1, d6pueh2 automated match to d1duzb_ complexed with gol, na, q7j |
PDB Entry: 6pue (more details), 1.9 Å
SCOPe Domain Sequences for d6puef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6puef1 b.1.1.2 (F:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d6puef1: