Lineage for d1aska_ (1ask A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78540Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 78561Family d.17.4.2: Nuclear transport factor-2 (NTF2) [54431] (1 protein)
  6. 78562Protein Nuclear transport factor-2 (NTF2) [54432] (1 species)
  7. 78563Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries)
  8. 78568Domain d1aska_: 1ask A: [38094]

Details for d1aska_

PDB Entry: 1ask (more details), 2.3 Å

PDB Description: nuclear transport factor 2 (ntf2) h66a mutant

SCOP Domain Sequences for d1aska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aska_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
gdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpf
qkiqasitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
alhnf

SCOP Domain Coordinates for d1aska_:

Click to download the PDB-style file with coordinates for d1aska_.
(The format of our PDB-style files is described here.)

Timeline for d1aska_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1askb_