Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6puca2: 6puc A:179-270 [380930] Other proteins in same PDB: d6puca1, d6puca3, d6pucb1, d6pucb2, d6pucc1, d6pucc3, d6pucd2, d6pucf1, d6pucf2, d6pucg2 automated match to d4l4va2 complexed with cl, gol, na, q87 |
PDB Entry: 6puc (more details), 1.85 Å
SCOPe Domain Sequences for d6puca2:
Sequence, based on SEQRES records: (download)
>d6puca2 b.1.1.0 (A:179-270) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqvp
>d6puca2 b.1.1.0 (A:179-270) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrktalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgtyqawasi eldpqssnlyschvehsgvhmvlqvp
Timeline for d6puca2: