Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6pulg1: 6pul G:1-116 [380910] Other proteins in same PDB: d6pula1, d6pula3, d6pulb2, d6pulc1, d6pulc3, d6puld2, d6pulf1, d6pulf2, d6pulh1, d6pulh2 automated match to d2axha1 complexed with act, gol, na, q81 |
PDB Entry: 6pul (more details), 1.84 Å
SCOPe Domain Sequences for d6pulg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pulg1 b.1.1.0 (G:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} nagvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgev pngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle
Timeline for d6pulg1: