SCOP 1.57: Domain d1ouna_: 1oun A:

Lineage for d1ouna_ (1oun A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.4: NTF2-like [54427] (4 families)

5. Family d.17.4.2: Nuclear transport factor-2 (NTF2) [54431] (1 protein)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries)

8. Domain d1ouna_: 1oun A: [38090]

Details for d1ouna_

PDB Entry: 1oun, 2.3 Å

PDB Description: crystal structure of nuclear transport factor 2 (ntf2)

SCOP Domain Sequences for d1ouna_:

Sequence; same for both SEQRES and ATOM records:

>d1ouna_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
gdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpf
qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
alhnf

Timeline for d1ouna_:

• d1ouna_ first appeared (with stable ids) in SCOP 1.55
  
• d1ouna_ appears in SCOP 1.59
  
• d1ouna_ appears in the current release, SCOPe 2.08