Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6pufd2: 6puf D:111-198 [380891] Other proteins in same PDB: d6pufa1, d6pufa2, d6pufa3, d6pufb1, d6pufb2, d6pufc1, d6pufc2, d6pufc3, d6pufd1, d6pufe1, d6pufe2, d6puff1, d6puff2, d6pufg1, d6pufh1, d6pufh2 automated match to d2f54d2 complexed with 2lj, gol, na |
PDB Entry: 6puf (more details), 1.92 Å
SCOPe Domain Sequences for d6pufd2:
Sequence, based on SEQRES records: (download)
>d6pufd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d6pufd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn kacanafnnsiipedtffp
Timeline for d6pufd2: