SCOPe 2.08: Domain d6pukd2: 6puk D:111-199

Lineage for d6pukd2 (6puk D:111-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6pukd2: 6puk D:111-199 [380881]
   Other proteins in same PDB: d6puka1, d6puka2, d6puka3, d6pukb1, d6pukc1, d6pukc2, d6pukc3, d6pukd1, d6puke1, d6puke2, d6pukf1, d6pukf2, d6pukg1, d6pukg2, d6pukh1, d6pukh2
   automated match to d2f54d2
   complexed with act, gol, na, oyv

Details for d6pukd2

PDB Entry: 6puk, 2.08 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-jym72

PDB Compounds: (D:) TRA@ protein

SCOPe Domain Sequences for d6pukd2:

Sequence, based on SEQRES records:

>d6pukd2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6pukd2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsnksdfacanafnnsiipedtffps

Timeline for d6pukd2:

• d6pukd2 first appeared in SCOPe 2.07