Lineage for d4stdc1 (4std C:10-172)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505361Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
    automatically mapped to Pfam PF02982
  6. 2505362Protein Scytalone dehydratase [54429] (1 species)
  7. 2505363Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)
  8. 2505383Domain d4stdc1: 4std C:10-172 [38088]
    Other proteins in same PDB: d4stda2, d4stdb2, d4stdc2
    complexed with bfs

Details for d4stdc1

PDB Entry: 4std (more details), 2.15 Å

PDB Description: high resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
PDB Compounds: (C:) scytalone dehydratase

SCOPe Domain Sequences for d4stdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4stdc1 d.17.4.1 (C:10-172) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
eitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvgm
vsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghahs
anlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk

SCOPe Domain Coordinates for d4stdc1:

Click to download the PDB-style file with coordinates for d4stdc1.
(The format of our PDB-style files is described here.)

Timeline for d4stdc1: