Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.1: Scytalone dehydratase [54428] (1 protein) automatically mapped to Pfam PF02982 |
Protein Scytalone dehydratase [54429] (1 species) |
Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries) |
Domain d2stda_: 2std A: [38085] complexed with crp, so4 |
PDB Entry: 2std (more details), 2.1 Å
SCOPe Domain Sequences for d2stda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2stda_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]} deitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfg
Timeline for d2stda_: