Lineage for d5stdc_ (5std C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.1: Scytalone dehydratase [54428] (1 protein) Protein Scytalone dehydratase [54429] (1 species) Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (7 PDB entries) 
Domain d5stdc_: 5std C: [38084]
Details for d5stdc_
PDB Entry: 5std (more details), 1.95 Å
PDB Description: scytalone dehydratase plus inhibitor 2
SCOP Domain Sequences for d5stdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5stdc_ d.17.4.1 (C:) Scytalone dehydratase {Fungus (Magnaporthe grisea)}
geitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg
mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah
sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk
SCOP Domain Coordinates for d5stdc_:
Click to download the PDB-style file with coordinates for d5stdc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5stdc_:
- d5stdc_ appears in SCOP 1.57
- d5stdc_ appears in the current release, SCOPe 2.08, called d5stdc1
View in 3D
