Lineage for d5stdb1 (5std B:10-172)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505361Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
    automatically mapped to Pfam PF02982
  6. 2505362Protein Scytalone dehydratase [54429] (1 species)
  7. 2505363Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)
  8. 2505378Domain d5stdb1: 5std B:10-172 [38083]
    Other proteins in same PDB: d5stda2, d5stdb2, d5stdc2
    complexed with ca, unn

Details for d5stdb1

PDB Entry: 5std (more details), 1.95 Å

PDB Description: scytalone dehydratase plus inhibitor 2
PDB Compounds: (B:) scytalone dehydratase

SCOPe Domain Sequences for d5stdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5stdb1 d.17.4.1 (B:10-172) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
eitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvgm
vsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghahs
anlhwykkidgvwkfaglkpdirwgefdfdrifedgretfgdk

SCOPe Domain Coordinates for d5stdb1:

Click to download the PDB-style file with coordinates for d5stdb1.
(The format of our PDB-style files is described here.)

Timeline for d5stdb1: