SCOPe 2.08: Domain d6puha1: 6puh A:1-178

Lineage for d6puha1 (6puh A:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6puha1: 6puh A:1-178 [380770]
   Other proteins in same PDB: d6puha2, d6puha3, d6puhb1, d6puhb2, d6puhc2, d6puhc3, d6puhd1, d6puhd2, d6puhe1, d6puhe2, d6puhf1, d6puhf2, d6puhg1, d6puhg2, d6puhh1, d6puhh2
   automated match to d4l4va1
   complexed with na, oyg

Details for d6puha1

PDB Entry: 6puh, 1.88 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-ribityl- less

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6puha1:

Sequence; same for both SEQRES and ATOM records:

>d6puha1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d6puha1:

• d6puha1 first appeared in SCOPe 2.07