Lineage for d6nxxb_ (6nxx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826605Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (8 PDB entries)
  8. 2826611Domain d6nxxb_: 6nxx B: [380759]
    automated match to d1tmha_
    complexed with na; mutant

Details for d6nxxb_

PDB Entry: 6nxx (more details), 1.64 Å

PDB Description: crystal structure of arabidopsis thaliana cytosolic triosephosphate isomerase c218k mutant
PDB Compounds: (B:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6nxxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nxxb_ c.1.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
markffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdf
fvaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaq
glkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspa
qaqevhdelrkwlaknvsadvaattriiyggsvnggnkkelggqadvdgflvggaslkpe
fidiikaaev

SCOPe Domain Coordinates for d6nxxb_:

Click to download the PDB-style file with coordinates for d6nxxb_.
(The format of our PDB-style files is described here.)

Timeline for d6nxxb_: