Lineage for d3stdb_ (3std B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181456Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
    automatically mapped to Pfam PF02982
  6. 2181457Protein Scytalone dehydratase [54429] (1 species)
  7. 2181458Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)
  8. 2181463Domain d3stdb_: 3std B: [38074]
    complexed with ca, mq0

Details for d3stdb_

PDB Entry: 3std (more details), 1.65 Å

PDB Description: scytalone dehydratase and cyanocinnoline inhibitor
PDB Compounds: (B:) protein (scytalone dehydratase)

SCOPe Domain Sequences for d3stdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stdb_ d.17.4.1 (B:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
geitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg
mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah
sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfg

SCOPe Domain Coordinates for d3stdb_:

Click to download the PDB-style file with coordinates for d3stdb_.
(The format of our PDB-style files is described here.)

Timeline for d3stdb_: