SCOPe 2.06: Domain d1eejb2: 1eej B:1-60

Lineage for d1eejb2 (1eej B:1-60)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families)

5. Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)

6. Protein Disulfide bond isomerase, DsbC, N-terminal domain [54425] (2 species)

7. Species Escherichia coli [TaxId:562] [54426] (6 PDB entries)
   Uniprot P21892

8. Domain d1eejb2: 1eej B:1-60 [38072]
   Other proteins in same PDB: d1eeja1, d1eejb1
   complexed with mes

Details for d1eejb2

PDB Entry: 1eej, 1.9 Å

PDB Description: crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli

PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d1eejb2:

Sequence; same for both SEQRES and ATOM records:

>d1eejb2 d.17.3.1 (B:1-60) Disulfide bond isomerase, DsbC, N-terminal domain {Escherichia coli [TaxId: 562]}
ddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsgtapv

Timeline for d1eejb2:

• d1eejb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eejb2 appears in SCOPe 2.05
  
• d1eejb2 appears in SCOPe 2.07
  
• d1eejb2 appears in the current release, SCOPe 2.08