Lineage for d1eejb2 (1eej B:1-60)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936239Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2936240Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)
  6. 2936241Protein Disulfide bond isomerase, DsbC, N-terminal domain [54425] (2 species)
  7. 2936242Species Escherichia coli [TaxId:562] [54426] (6 PDB entries)
    Uniprot P21892
  8. 2936244Domain d1eejb2: 1eej B:1-60 [38072]
    Other proteins in same PDB: d1eeja1, d1eejb1
    complexed with mes

Details for d1eejb2

PDB Entry: 1eej (more details), 1.9 Å

PDB Description: crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d1eejb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eejb2 d.17.3.1 (B:1-60) Disulfide bond isomerase, DsbC, N-terminal domain {Escherichia coli [TaxId: 562]}
ddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsgtapv

SCOPe Domain Coordinates for d1eejb2:

Click to download the PDB-style file with coordinates for d1eejb2.
(The format of our PDB-style files is described here.)

Timeline for d1eejb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eejb1