SCOPe 2.08: Domain d6lgwb_: 6lgw B:

Lineage for d6lgwb_ (6lgw B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6lgwb_: 6lgw B: [380712]
   Other proteins in same PDB: d6lgwa_, d6lgwc_
   automated match to d4lrnl_

Details for d6lgwb_

PDB Entry: 6lgw, 2.9 Å

PDB Description: structure of rabies virus glycoprotein in complex with neutralizing antibody 523-11 at acidic ph

PDB Compounds: (B:) scFv 523-11 VL

SCOPe Domain Sequences for d6lgwb_:

Sequence; same for both SEQRES and ATOM records:

>d6lgwb_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqspailsvspgervsfscrasqiigtsihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftltinsvesddiadyycqqsnswpvtfgagtkl

Timeline for d6lgwb_:

• d6lgwb_ first appeared in SCOPe 2.07