Lineage for d1eeja2 (1eej A:1-60)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543324Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2543325Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins)
  6. 2543326Protein Disulfide bond isomerase, DsbC, N-terminal domain [54425] (2 species)
  7. 2543327Species Escherichia coli [TaxId:562] [54426] (6 PDB entries)
    Uniprot P21892
  8. 2543328Domain d1eeja2: 1eej A:1-60 [38071]
    Other proteins in same PDB: d1eeja1, d1eejb1
    complexed with mes

Details for d1eeja2

PDB Entry: 1eej (more details), 1.9 Å

PDB Description: crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d1eeja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeja2 d.17.3.1 (A:1-60) Disulfide bond isomerase, DsbC, N-terminal domain {Escherichia coli [TaxId: 562]}
ddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsgtapv

SCOPe Domain Coordinates for d1eeja2:

Click to download the PDB-style file with coordinates for d1eeja2.
(The format of our PDB-style files is described here.)

Timeline for d1eeja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eeja1