Lineage for d1a2vf3 (1a2v F:116-236)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895888Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1895889Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1895890Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1896098Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 1896134Domain d1a2vf3: 1a2v F:116-236 [38070]
    Other proteins in same PDB: d1a2va1, d1a2vb1, d1a2vc1, d1a2vd1, d1a2ve1, d1a2vf1
    complexed with cu

Details for d1a2vf3

PDB Entry: 1a2v (more details), 2.4 Å

PDB Description: copper amine oxidase from hansenula polymorpha
PDB Compounds: (F:) methylamine oxidase

SCOPe Domain Sequences for d1a2vf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2vf3 d.17.2.1 (F:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOPe Domain Coordinates for d1a2vf3:

Click to download the PDB-style file with coordinates for d1a2vf3.
(The format of our PDB-style files is described here.)

Timeline for d1a2vf3: