| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
| Domain d1a2vd2: 1a2v D:18-115 [38065] Other proteins in same PDB: d1a2va1, d1a2vb1, d1a2vc1, d1a2vd1, d1a2ve1, d1a2vf1 |
PDB Entry: 1a2v (more details), 2.4 Å
SCOP Domain Sequences for d1a2vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2vd2 d.17.2.1 (D:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi
Timeline for d1a2vd2: