Lineage for d1a2vc2 (1a2v C:18-115)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30987Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 30988Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 30989Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 31039Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (2 PDB entries)
  8. 31050Domain d1a2vc2: 1a2v C:18-115 [38063]
    Other proteins in same PDB: d1a2va1, d1a2vb1, d1a2vc1, d1a2vd1, d1a2ve1, d1a2vf1

Details for d1a2vc2

PDB Entry: 1a2v (more details), 2.4 Å

PDB Description: copper amine oxidase from hansenula polymorpha

SCOP Domain Sequences for d1a2vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2vc2 d.17.2.1 (C:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha)}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOP Domain Coordinates for d1a2vc2:

Click to download the PDB-style file with coordinates for d1a2vc2.
(The format of our PDB-style files is described here.)

Timeline for d1a2vc2: