![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
![]() | Domain d1a2vb2: 1a2v B:18-115 [38061] Other proteins in same PDB: d1a2va1, d1a2vb1, d1a2vc1, d1a2vd1, d1a2ve1, d1a2vf1 complexed with cu |
PDB Entry: 1a2v (more details), 2.4 Å
SCOPe Domain Sequences for d1a2vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2vb2 d.17.2.1 (B:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]} parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr layyvileagkpgvkeglvdlaslsvietraletvqpi
Timeline for d1a2vb2: