![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
![]() | Domain d1ekmc3: 1ekm C:116-236 [38058] Other proteins in same PDB: d1ekma1, d1ekmb1, d1ekmc1 complexed with zn |
PDB Entry: 1ekm (more details), 2.5 Å
SCOPe Domain Sequences for d1ekmc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekmc3 d.17.2.1 (C:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]} ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam r
Timeline for d1ekmc3: