Lineage for d1ekmc2 (1ekm C:17-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640720Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 1640761Domain d1ekmc2: 1ekm C:17-115 [38057]
    Other proteins in same PDB: d1ekma1, d1ekmb1, d1ekmc1
    complexed with zn

Details for d1ekmc2

PDB Entry: 1ekm (more details), 2.5 Å

PDB Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli
PDB Compounds: (C:) copper amine oxidase

SCOPe Domain Sequences for d1ekmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekmc2 d.17.2.1 (C:17-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
rlayyvileagkpgvkeglvdlaslsvietraletvqpi

SCOPe Domain Coordinates for d1ekmc2:

Click to download the PDB-style file with coordinates for d1ekmc2.
(The format of our PDB-style files is described here.)

Timeline for d1ekmc2: