Lineage for d6r8hb_ (6r8h B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435176Species Fasciola hepatica [TaxId:6192] [380481] (1 PDB entry)
  8. 2435178Domain d6r8hb_: 6r8h B: [380537]
    automated match to d1suxa_
    complexed with so4

Details for d6r8hb_

PDB Entry: 6r8h (more details), 1.9 Å

PDB Description: triosephosphate isomerase from liver fluke (fasciola hepatica).
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d6r8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r8hb_ c.1.1.0 (B:) automated matches {Fasciola hepatica [TaxId: 6192]}
asnrkffvggnwkmngskesnqkllktlsdakpdanteilvavpfvylkdvrehldkrfh
vaaqncykvasgaftgeispamirdcgcewvilghserrhifgesdeligekvnhaltcg
lkvvpcigekldereagkteqvcfrqldaikkgipkaedwsrvviayepvwaigtgktas
peqaqevhhavrqwleknvsqavasslrityggsvtaanckelakkpdvdgflvggaslk
pefvdicnan

SCOPe Domain Coordinates for d6r8hb_:

Click to download the PDB-style file with coordinates for d6r8hb_.
(The format of our PDB-style files is described here.)

Timeline for d6r8hb_: