Lineage for d5qu4b1 (5qu4 B:2-62)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377559Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 3080468Domain d5qu4b1: 5qu4 B:2-62 [380530]
    Other proteins in same PDB: d5qu4b2
    automated match to d5hcka_

Details for d5qu4b1

PDB Entry: 5qu4 (more details), 1.05 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.05a, orthorhombic form i
PDB Compounds: (B:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qu4b1 b.34.2.0 (B:2-62) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn
s

SCOPe Domain Coordinates for d5qu4b1:

Click to download the PDB-style file with coordinates for d5qu4b1.
(The format of our PDB-style files is described here.)

Timeline for d5qu4b1:

  • d5qu4b1 is new in SCOPe 2.07-stable