SCOPe 2.08: Domain d6qj7a_: 6qj7 A:

Lineage for d6qj7a_ (6qj7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [352703] (8 PDB entries)

8. Domain d6qj7a_: 6qj7 A: [380501]
   Other proteins in same PDB: d6qj7b_
   automated match to d1smha_
   complexed with j4b

Details for d6qj7a_

PDB Entry: 6qj7, 1.69 Å

PDB Description: difluorophenyl diacylhydrazides: potent inhibitors of serum- and glucocorticoid-inducible kinase 1 (sgk1)

PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d6qj7a_:

Sequence; same for both SEQRES and ATOM records:

>d6qj7a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Human (Homo sapiens) [TaxId: 9606]}
esvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d6qj7a_:

• d6qj7a_ first appeared in SCOPe 2.07