![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [352703] (8 PDB entries) |
![]() | Domain d6qj7a_: 6qj7 A: [380501] Other proteins in same PDB: d6qj7b_ automated match to d1smha_ complexed with j4b |
PDB Entry: 6qj7 (more details), 1.69 Å
SCOPe Domain Sequences for d6qj7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qj7a_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Human (Homo sapiens) [TaxId: 9606]} esvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamk ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d6qj7a_: