Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) |
Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (7 PDB entries) |
Domain d1av4_3: 1av4 97-211 [38050] Other proteins in same PDB: d1av4_1 |
PDB Entry: 1av4 (more details), 2.2 Å
SCOP Domain Sequences for d1av4_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1av4_3 d.17.2.1 (97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis} elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
Timeline for d1av4_3: