Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (23 species) not a true protein |
Species Homo sapiens [TaxId:9606] [364675] (4 PDB entries) |
Domain d6kpgr_: 6kpg R: [380476] Other proteins in same PDB: d6kpgb_, d6kpgc_, d6kpgs1, d6kpgs2 automated match to d4bvna_ complexed with 8d0 |
PDB Entry: 6kpg (more details), 3 Å
SCOPe Domain Sequences for d6kpgr_:
Sequence, based on SEQRES records: (download)
>d6kpgr_ f.13.1.0 (R:) automated matches {Homo sapiens [TaxId: 9606]} ecfmvlnpsqqlaiavlsltlgtftvlenllvlcvilhsrslrcrpsyhfigslavadll gsvifvysfidfhvfhrkdsrnvflfklggvtasftasvgslfltaidryisihrplayk rivtrpkavvafclmwtiaiviavlpllgwnceklqsvcsdifphidktylmfwigvvsv lllfivyaymyilwkahshavrmiqrgtqksiiihtsedgkvqvtrpdqarmdielaktl vlilvvliicwgpllaimvydvfgkmnkliktvfafcsmlcllnstvnpiiyalrskdlr hafrsm
>d6kpgr_ f.13.1.0 (R:) automated matches {Homo sapiens [TaxId: 9606]} ecfmvlnpsqqlaiavlsltlgtftvlenllvlcvilhsrslrcrpsyhfigslavadll gsvifvysfidfhvfhrkdsrnvflfklggvtasftasvgslfltaidryisihrplayk rivtrpkavvafclmwtiaiviavlpllgwnceklqsvcsdifphidktylmfwigvvsv lllfivyaymyilwkahshavrmiqrgtarmdielaktlvlilvvliicwgpllaimvyd vfgkmnkliktvfafcsmlcllnstvnpiiyalrskdlrhafrsm
Timeline for d6kpgr_:
View in 3D Domains from other chains: (mouse over for more information) d6kpgb_, d6kpgc_, d6kpgs1, d6kpgs2 |