Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries) |
Domain d5qu4a_: 5qu4 A: [380466] Other proteins in same PDB: d5qu4b2 automated match to d5hcka_ |
PDB Entry: 5qu4 (more details), 1.05 Å
SCOPe Domain Sequences for d5qu4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qu4a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn
Timeline for d5qu4a_:
View in 3D Domains from other chains: (mouse over for more information) d5qu4b1, d5qu4b2, d5qu4c_, d5qu4d_ |