Lineage for d5qu4a_ (5qu4 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. Protein automated matches [190457] (10 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187598] (104 PDB entries)
  8. Domain d5qu4a_: 5qu4 A: [380466]
    Other proteins in same PDB: d5qu4b2
    automated match to d5hcka_

Details for d5qu4a_

PDB Entry: 5qu4 (more details), 1.05 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.05a, orthorhombic form i
PDB Compounds: (A:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qu4a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn

SCOPe Domain Coordinates for d5qu4a_ are not available.

Timeline for d5qu4a_:

Domains from other chains:
(mouse over for more information)
d5qu4b1, d5qu4b2, d5qu4c_, d5qu4d_