![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.17: Cystatin-like [54402] (5 superfamilies) |
![]() | Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Pea seedling (Pisum sativum) [TaxId:3888] [54420] (1 PDB entry) |
![]() | Domain d1ksib3: 1ksi B:99-206 [38046] Other proteins in same PDB: d1ksia1, d1ksib1 |
PDB Entry: 1ksi (more details), 2.2 Å
SCOP Domain Sequences for d1ksib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksib3 d.17.2.1 (B:99-206) Copper amine oxidase, domains 1 and 2 {Pea seedling (Pisum sativum)} gfpilsvdeqslaiklplkyppfidsvkkrglnlseivcssftmgwfgeeknvrtvrldc fmkestvniyvrpitgitivadldlmkiveyhdrdieavptaenteyq
Timeline for d1ksib3: