SCOPe 2.07: Domain d6nyub_: 6nyu B:

Lineage for d6nyub_ (6nyu B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [347708] (7 PDB entries)

8. Domain d6nyub_: 6nyu B: [380427]
   automated match to d3pl5a_
   complexed with gol, myr, plm; mutant

Details for d6nyub_

PDB Entry: 6nyu, 2.18 Å

PDB Description: the x-ray crystal structure of staphylococcus aureus fatty acid kinase (fak) b1 f263t mutant protein to 2.18 angstrom resolution

PDB Compounds: (B:) DegV domain-containing protein

SCOPe Domain Sequences for d6nyub_:

Sequence, based on SEQRES records:

>d6nyub_ c.119.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgaqaw
vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
gqalykklqddcpsayqvaysetgpvvaahlgsgglglgyvgrkirlt

Sequence, based on observed residues (ATOM records):

>d6nyub_ c.119.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritglkmk
pvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfedgqalykkl
qddcpsayqvaysetgpvvaahlgsgglglgyvgrkirlt

Timeline for d6nyub_:

• d6nyub_ is new in SCOPe 2.07-stable
  
• d6nyub_ appears in the current release, SCOPe 2.08