SCOPe 2.07: Domain d6nxsa1: 6nxs A:3-250

Lineage for d6nxsa1 (6nxs A:3-250)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (25 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (8 PDB entries)

8. Domain d6nxsa1: 6nxs A:3-250 [380422]
   Other proteins in same PDB: d6nxsa2, d6nxsb2
   automated match to d1tmha_
   complexed with na; mutant

Details for d6nxsa1

PDB Entry: 6nxs, 1.52 Å

PDB Description: crystal structure of arabidopsis thaliana cytosolic triosephosphate isomerase c218y mutant

PDB Compounds: (A:) Triosephosphate isomerase, cytosolic

SCOPe Domain Sequences for d6nxsa1:

Sequence; same for both SEQRES and ATOM records:

>d6nxsa1 c.1.1.0 (A:3-250) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdffv
aaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqgl
kviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaqa
qevhdelrkwlaknvsadvaattriiyggsvnggnykelggqadvdgflvggaslkpefi
diikaaev

Timeline for d6nxsa1:

• d6nxsa1 is new in SCOPe 2.07-stable
  
• d6nxsa1 appears in the current release, SCOPe 2.08