SCOPe 2.08: Domain d6kpfs2: 6kpf S:124-235

Lineage for d6kpfs2 (6kpf S:124-235)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6kpfs2: 6kpf S:124-235 [380420]
   Other proteins in same PDB: d6kpfb_, d6kpfc_, d6kpfr_
   automated match to d5i4fa2
   complexed with 8d0

Details for d6kpfs2

PDB Entry: 6kpf, 2.9 Å

PDB Description: cryo-em structure of a class a gpcr with g protein complex

PDB Compounds: (S:) scFv16

SCOPe Domain Sequences for d6kpfs2:

Sequence; same for both SEQRES and ATOM records:

>d6kpfs2 b.1.1.0 (S:124-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnl
asgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfgagtklel

Timeline for d6kpfs2:

• d6kpfs2 first appeared in SCOPe 2.07