Lineage for d6nv8a_ (6nv8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895601Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 2895628Protein Tyrosine phenol-lyase [53398] (3 species)
  7. 2895629Species Citrobacter freundii [TaxId:546] [419777] (13 PDB entries)
  8. 2895650Domain d6nv8a_: 6nv8 A: [380416]
    automated match to d2vlfa_
    complexed with 0jo, cqg, dha, k, p33

Details for d6nv8a_

PDB Entry: 6nv8 (more details), 2.26 Å

PDB Description: perdeuterated tyrosine phenol-lyase from citrobacter freundii complexed with an aminoacrylate intermediate formed from s-ethyl-l- cysteine and 4-hydroxypyridine
PDB Compounds: (A:) tyrosine phenol-lyase

SCOPe Domain Sequences for d6nv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nv8a_ c.67.1.2 (A:) Tyrosine phenol-lyase {Citrobacter freundii [TaxId: 546]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
dgiiklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d6nv8a_:

Click to download the PDB-style file with coordinates for d6nv8a_.
(The format of our PDB-style files is described here.)

Timeline for d6nv8a_: