Lineage for d1qalb2 (1qal B:91-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2543046Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2543047Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2543177Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2543224Domain d1qalb2: 1qal B:91-185 [38041]
    Other proteins in same PDB: d1qala1, d1qala4, d1qalb1, d1qalb4
    complexed with ca, cu; mutant

Details for d1qalb2

PDB Entry: 1qal (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1qalb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qalb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOPe Domain Coordinates for d1qalb2:

Click to download the PDB-style file with coordinates for d1qalb2.
(The format of our PDB-style files is described here.)

Timeline for d1qalb2: