| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
| Domain d1qala3: 1qal A:186-300 [38040] Other proteins in same PDB: d1qala1, d1qala4, d1qalb1, d1qalb4 complexed with ca, cu; mutant |
PDB Entry: 1qal (more details), 2.2 Å
SCOPe Domain Sequences for d1qala3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qala3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1qala3:
View in 3DDomains from other chains: (mouse over for more information) d1qalb1, d1qalb2, d1qalb3, d1qalb4 |