![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [380329] (6 PDB entries) |
![]() | Domain d6jf4b_: 6jf4 B: [380397] automated match to d2defa_ complexed with k1u, zn |
PDB Entry: 6jf4 (more details), 2 Å
SCOPe Domain Sequences for d6jf4b_:
Sequence, based on SEQRES records: (download)
>d6jf4b_ d.167.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr viivasrpnprypdapemnavvmvnpeilefssetclgeegclsvpdergqveraemvkv kyltlqgeavetifhgfparivqhevdhlngilfveri
>d6jf4b_ d.167.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr viivasrpnapemnavvmvnpeilefssetclgeegclsvpdergqveraemvkvkyltl qgeavetifhgfparivqhevdhlngilfveri
Timeline for d6jf4b_: