Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (10 species) not a true protein |
Species Acinetobacter baumannii [TaxId:1409923] [380325] (6 PDB entries) |
Domain d6jerb_: 6jer B: [380390] automated match to d1bs4a_ complexed with zn |
PDB Entry: 6jer (more details), 2.4 Å
SCOPe Domain Sequences for d6jerb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jerb_ d.167.1.1 (B:) automated matches {Acinetobacter baumannii [TaxId: 1409923]} llpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivmd lseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafei eadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekv
Timeline for d6jerb_: