SCOPe 2.07: Domain d6jerb_: 6jer B:

Lineage for d6jerb_ (6jer B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:1409923] [380325] (6 PDB entries)

8. Domain d6jerb_: 6jer B: [380390]
   automated match to d1bs4a_
   complexed with zn

Details for d6jerb_

PDB Entry: 6jer, 2.4 Å

PDB Description: apo crystal structure of class i type a peptide deformylase from acinetobacter baumannii

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d6jerb_:

Sequence; same for both SEQRES and ATOM records:

>d6jerb_ d.167.1.1 (B:) automated matches {Acinetobacter baumannii [TaxId: 1409923]}
llpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivmd
lseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafei
eadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekv

Timeline for d6jerb_:

• d6jerb_ is new in SCOPe 2.07-stable
  
• d6jerb_ appears in the current release, SCOPe 2.08