Lineage for d6jerb_ (6jer B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3001072Protein automated matches [190200] (9 species)
    not a true protein
  7. 3001073Species Acinetobacter baumannii [TaxId:1409923] [380325] (6 PDB entries)
  8. 3001083Domain d6jerb_: 6jer B: [380390]
    automated match to d1bs4a_
    complexed with zn

Details for d6jerb_

PDB Entry: 6jer (more details), 2.4 Å

PDB Description: apo crystal structure of class i type a peptide deformylase from acinetobacter baumannii
PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d6jerb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jerb_ d.167.1.1 (B:) automated matches {Acinetobacter baumannii [TaxId: 1409923]}
llpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivmd
lseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafei
eadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekv

SCOPe Domain Coordinates for d6jerb_:

Click to download the PDB-style file with coordinates for d6jerb_.
(The format of our PDB-style files is described here.)

Timeline for d6jerb_: