Lineage for d1d6yb3 (1d6y B:186-300)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2936092Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2936148Domain d1d6yb3: 1d6y B:186-300 [38038]
    Other proteins in same PDB: d1d6ya1, d1d6ya4, d1d6yb1, d1d6yb4
    complexed with ca, cu, gol, hy1, no, pea

Details for d1d6yb3

PDB Entry: 1d6y (more details), 2.4 Å

PDB Description: crystal structure of e. coli copper-containing amine oxidase anaerobically reduced with beta-phenylethylamine and complexed with nitric oxide.
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6yb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6yb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d1d6yb3:

Click to download the PDB-style file with coordinates for d1d6yb3.
(The format of our PDB-style files is described here.)

Timeline for d1d6yb3: