Lineage for d1d6yb2 (1d6y B:91-185)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78463Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 78464Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 78465Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 78473Species Escherichia coli [TaxId:562] [54419] (9 PDB entries)
  8. 78504Domain d1d6yb2: 1d6y B:91-185 [38037]
    Other proteins in same PDB: d1d6ya1, d1d6ya4, d1d6yb1, d1d6yb4

Details for d1d6yb2

PDB Entry: 1d6y (more details), 2.4 Å

PDB Description: crystal structure of e. coli copper-containing amine oxidase anaerobically reduced with beta-phenylethylamine and complexed with nitric oxide.

SCOP Domain Sequences for d1d6yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6yb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1d6yb2:

Click to download the PDB-style file with coordinates for d1d6yb2.
(The format of our PDB-style files is described here.)

Timeline for d1d6yb2: