| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
| Domain d1d6ya3: 1d6y A:186-300 [38036] Other proteins in same PDB: d1d6ya1, d1d6ya4, d1d6yb1, d1d6yb4 complexed with ca, cu, gol, hy1, no, pea |
PDB Entry: 1d6y (more details), 2.4 Å
SCOPe Domain Sequences for d1d6ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ya3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1d6ya3:
View in 3DDomains from other chains: (mouse over for more information) d1d6yb1, d1d6yb2, d1d6yb3, d1d6yb4 |