SCOPe 2.08: Domain d6jesa_: 6jes A:

Lineage for d6jesa_ (6jes A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [380329] (6 PDB entries)

8. Domain d6jesa_: 6jes A: [380349]
   automated match to d2defa_
   complexed with gol, zn

Details for d6jesa_

PDB Entry: 6jes, 1.75 Å

PDB Description: apo crystal structure of class i type b peptide deformylase from acinetobacter baumannii

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6jesa_:

Sequence; same for both SEQRES and ATOM records:

>d6jesa_ d.167.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr
viivasrpnprypdapemnavvmvnpeilefssemclgeegclsvpdergqveraemvkv
kyltlqgemvetvfqgfparivqhevdhlngilfveris

Timeline for d6jesa_:

• d6jesa_ first appeared in SCOPe 2.07