Lineage for d6jf9a_ (6jf9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001197Species Pseudomonas aeruginosa [TaxId:287] [380338] (6 PDB entries)
  8. 3001198Domain d6jf9a_: 6jf9 A: [380339]
    automated match to d5kobc_
    complexed with gol, ni

Details for d6jf9a_

PDB Entry: 6jf9 (more details), 1.7 Å

PDB Description: apo crystal structure of class i type b peptide deformylase from pseudomonas aeruginosa
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6jf9a_:

Sequence, based on SEQRES records: (download)

>d6jf9a_ d.167.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgferserypdapavpptillnpritplddemeegwegclsvpglrgavsrhrriryqg
ldpqgqpidrsvegfharvvqhecdhligrlypsritdfskfgftevl

Sequence, based on observed residues (ATOM records): (download)

>d6jf9a_ d.167.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgfpavpptillnpritplddemeegwegclsvpglrgavsrhrriryqgldpqgqpid
rsvegfharvvqhecdhligrlypsritdfskfgftevl

SCOPe Domain Coordinates for d6jf9a_:

Click to download the PDB-style file with coordinates for d6jf9a_.
(The format of our PDB-style files is described here.)

Timeline for d6jf9a_: