Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
Protein automated matches [229446] (3 species) not a true protein |
Species Chromobacterium violaceum [TaxId:243365] [380315] (2 PDB entries) |
Domain d6ecyb1: 6ecy B:1-142 [380333] Other proteins in same PDB: d6ecya2, d6ecyb2 automated match to d4xx2a_ |
PDB Entry: 6ecy (more details), 1.4 Å
SCOPe Domain Sequences for d6ecyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ecyb1 d.227.1.1 (B:1-142) automated matches {Chromobacterium violaceum [TaxId: 243365]} mnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeqlfaagysa cfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerdaglrliea ahgicpysnatrgnieveltla
Timeline for d6ecyb1: