SCOPe 2.08: Domain d6ecyb1: 6ecy B:1-142

Lineage for d6ecyb1 (6ecy B:1-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)

6. Protein automated matches [229446] (3 species)
   not a true protein

7. Species Chromobacterium violaceum [TaxId:243365] [380315] (2 PDB entries)

8. Domain d6ecyb1: 6ecy B:1-142 [380333]
   Other proteins in same PDB: d6ecya2, d6ecyb2
   automated match to d4xx2a_

Details for d6ecyb1

PDB Entry: 6ecy, 1.4 Å

PDB Description: ohra (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum

PDB Compounds: (B:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6ecyb1:

Sequence; same for both SEQRES and ATOM records:

>d6ecyb1 d.227.1.1 (B:1-142) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeqlfaagysa
cfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerdaglrliea
ahgicpysnatrgnieveltla

Timeline for d6ecyb1:

• d6ecyb1 first appeared in SCOPe 2.07