SCOPe 2.08: Domain d6jeua_: 6jeu A:

Lineage for d6jeua_ (6jeu A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (9 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:1409923] [380325] (6 PDB entries)

8. Domain d6jeua_: 6jeu A: [380326]
   automated match to d1bs4a_
   complexed with k1u, zn

Details for d6jeua_

PDB Entry: 6jeu, 2.1 Å

PDB Description: k1u bound crystal peptide deformylase from acinetobacter baumanii

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6jeua_:

Sequence; same for both SEQRES and ATOM records:

>d6jeua_ d.167.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 1409923]}
allpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivm
dlseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafe
ieadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerek

Timeline for d6jeua_:

• d6jeua_ first appeared in SCOPe 2.07